ST6GALNAC6 Antikörper (C-Term)

Produktnummer ABIN635440

Produktdetails anti-ST6GALNAC6 Antikörper

Target: ST6GALNAC6 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST6GALNAC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ST6 GALNAC6 antibody was raised against the C terminal of ST6 ALNAC6

Aufreinigung: Affinity purified

Immunogen: ST6 GALNAC6 antibody was raised using the C terminal of ST6 ALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST6GALNAC6 Blocking Peptide, catalog no. 33R-10129, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST6GALNAC6

Target: ST6GALNAC6 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6))

Andere Bezeichnung: ST6GALNAC6 (ST6GALNAC6 Produkte)

Synonyme: RP11-203J24.3 antikoerper, SIAT7F antikoerper, ST6GALNACVI antikoerper, siat7f antikoerper, st6GalNAc-VI antikoerper, Siat7f antikoerper, MGC109387 antikoerper, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 antikoerper, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 antikoerper, ST6GALNAC6 antikoerper, St6galnac6 antikoerper

Hintergrund: ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

Molekulargewicht: 38 kDa (MW of target protein)