TMEM69 Antikörper (Middle Region)

Produktnummer ABIN635451

Produktdetails anti-TMEM69 Antikörper

Target: TMEM69 (Transmembrane Protein 69 (TMEM69))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM69 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Spezifität: TMEM69 antibody was raised against the middle region of TMEM69

Aufreinigung: Affinity purified

Immunogen: TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM69 Blocking Peptide, catalog no. 33R-1628, is also available for use as a blocking control in assays to test for specificity of this TMEM69 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM69 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM69

Target: TMEM69 (Transmembrane Protein 69 (TMEM69))

Andere Bezeichnung: TMEM69 (TMEM69 Produkte)

Synonyme: zgc:194288 antikoerper, zgc:194295 antikoerper, C1orf154 antikoerper, RP11-767N6.4 antikoerper, A630048M13Rik antikoerper, Transmembrane protein 69 antikoerper, transmembrane protein 69 antikoerper, tmm69 antikoerper, TMEM69 antikoerper, tmem69 antikoerper, Tmem69 antikoerper

Hintergrund: The function of TMEM69 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 27 kDa (MW of target protein)