TMEM161A Antikörper (Middle Region)

Produktnummer ABIN635452

Produktdetails anti-TMEM161A Antikörper

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM161A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM161 A antibody was raised against the middle region of TMEM161

Aufreinigung: Affinity purified

Immunogen: TMEM161 A antibody was raised using the middle region of TMEM161 corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM161A Blocking Peptide, catalog no. 33R-5117, is also available for use as a blocking control in assays to test for specificity of this TMEM161A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM161A

Target: TMEM161A (Transmembrane Protein 161A (TMEM161A))

Andere Bezeichnung: TMEM161A (TMEM161A Produkte)

Synonyme: AROS-29 antikoerper, AI428876 antikoerper, BB161850 antikoerper, BC021367 antikoerper, RGD1307703 antikoerper, transmembrane protein 161A antikoerper, transmembrane protein 161A L homeolog antikoerper, TMEM161A antikoerper, Tmem161a antikoerper, tmem161a.L antikoerper

Hintergrund: TMEM161A may be involved in the development of dendritic cells.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus