TMEM127 Antikörper (Middle Region)

Produktnummer ABIN635454

Produktdetails anti-TMEM127 Antikörper

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM127 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM127 antibody was raised against the middle region of TMEM127

Aufreinigung: Affinity purified

Immunogen: TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM127 Blocking Peptide, catalog no. 33R-1166, is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM127

Target: TMEM127 (Transmembrane Protein 127 (TMEM127))

Andere Bezeichnung: TMEM127 (TMEM127 Produkte)

Synonyme: zgc:109899 antikoerper, 2310003P10Rik antikoerper, AI314202 antikoerper, AI317350 antikoerper, RGD1309744 antikoerper, transmembrane protein 127 antikoerper, transmembrane protein 127 S homeolog antikoerper, tmem127 antikoerper, TMEM127 antikoerper, tmem127.S antikoerper, Tmem127 antikoerper

Hintergrund: TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.

Molekulargewicht: 26 kDa (MW of target protein)