TMEM127 Antikörper (Middle Region)
-
- Target Alle TMEM127 Antikörper anzeigen
- TMEM127 (Transmembrane Protein 127 (TMEM127))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM127 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM127 antibody was raised against the middle region of TMEM127
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ
- Top Product
- Discover our top product TMEM127 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM127 Blocking Peptide, catalog no. 33R-1166, is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM127 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM127 (Transmembrane Protein 127 (TMEM127))
- Andere Bezeichnung
- TMEM127 (TMEM127 Produkte)
- Hintergrund
- TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.
- Molekulargewicht
- 26 kDa (MW of target protein)
-