FAM70A Antikörper (N-Term)
-
- Target Alle FAM70A Produkte
- FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM70A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM70 A antibody was raised against the N terminal of FAM70
- Aufreinigung
- Affinity purified
- Immunogen
- FAM70 A antibody was raised using the N terminal of FAM70 corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM70A Blocking Peptide, catalog no. 33R-4195, is also available for use as a blocking control in assays to test for specificity of this FAM70A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM70A (Family with Sequence Similarity 70, Member A (FAM70A))
- Andere Bezeichnung
- FAM70A (FAM70A Produkte)
- Synonyme
- FAM70A antikoerper, 4933417N17 antikoerper, 6430550H21Rik antikoerper, Fam70a antikoerper, RGD727788 antikoerper, fam70a antikoerper, transmembrane protein 255A antikoerper, transmembrane protein 255A L homeolog antikoerper, TMEM255A antikoerper, Tmem255a antikoerper, tmem255a.L antikoerper, tmem255a antikoerper
- Hintergrund
- The function of FAM70A protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 38 kDa (MW of target protein)
-