HLC8 Antikörper (N-Term)

Produktnummer ABIN635456

Produktdetails anti-HLC8 Antikörper

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HLC8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C17 ORF80 antibody was raised against the N terminal Of C17 rf80

Aufreinigung: Affinity purified

Immunogen: C17 ORF80 antibody was raised using the N terminal Of C17 rf80 corresponding to a region with amino acids MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF80 Blocking Peptide, catalog no. 33R-6409, is also available for use as a blocking control in assays to test for specificity of this C17ORF80 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HLC8

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Andere Bezeichnung: C17ORF80 (C17orf80 Produkte)

Synonyme: HLC-8 antikoerper, MIG3 antikoerper, SPEP1 antikoerper, mig3 antikoerper, hlc-8 antikoerper, chromosome 17 open reading frame 80 antikoerper, chromosome 18 open reading frame, human C17orf80 antikoerper, chromosome 17 open reading frame, human C17orf80 antikoerper, DNA segment, Chr 11, Wayne State University 47, expressed antikoerper, C17orf80 antikoerper, C17ORF80 antikoerper, C17H17orf80 antikoerper, c17orf80 antikoerper, D11Wsu47e antikoerper

Hintergrund: The function of C17orf80 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 67 kDa (MW of target protein)