SUSD4 Antikörper (Middle Region)

Produktnummer ABIN635458

Produktdetails anti-SUSD4 Antikörper

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUSD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SUSD4 antibody was raised against the middle region of SUSD4

Aufreinigung: Affinity purified

Immunogen: SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SUSD4 Blocking Peptide, catalog no. 33R-3734, is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUSD4

Target: SUSD4 (Sushi Domain Containing 4 (SUSD4))

Andere Bezeichnung: SUSD4 (SUSD4 Produkte)

Synonyme: susd4 antikoerper, MGC146481 antikoerper, DKFZp469E106 antikoerper, PRO222 antikoerper, AI848994 antikoerper, E430021N18Rik antikoerper, N28096 antikoerper, RGD1564043 antikoerper, sushi domain containing 4 antikoerper, toll-like receptor 5 antikoerper, SUSD4 antikoerper, tlr5 antikoerper, Susd4 antikoerper

Hintergrund: SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.

Molekulargewicht: 54 kDa (MW of target protein)