TEX2 Antikörper (N-Term)

Produktnummer ABIN635462

Produktdetails anti-TEX2 Antikörper

Target: TEX2 (Testis Expressed 2 (TEX2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TEX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TEX2 antibody was raised against the N terminal of TEX2

Aufreinigung: Affinity purified

Immunogen: TEX2 antibody was raised using the N terminal of TEX2 corresponding to a region with amino acids KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TEX2 Blocking Peptide, catalog no. 33R-4657, is also available for use as a blocking control in assays to test for specificity of this TEX2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TEX2

Target: TEX2 (Testis Expressed 2 (TEX2))

Andere Bezeichnung: TEX2 (TEX2 Produkte)

Synonyme: HT008 antikoerper, TMEM96 antikoerper, 4930568E07Rik antikoerper, AI553404 antikoerper, Def-5 antikoerper, Taz4 antikoerper, testis expressed 2 antikoerper, testis expressed gene 2 antikoerper, TEX2 antikoerper, Tex2 antikoerper

Hintergrund: TEX2 is a multi-pass membrane protein. The exact function of TEX2 remains unknown.

Molekulargewicht: 126 kDa (MW of target protein)