LRRC59 Antikörper (C-Term)

Produktnummer ABIN635464

Produktdetails anti-LRRC59 Antikörper

Target: LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC59 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC59 antibody was raised against the C terminal of LRRC59

Aufreinigung: Affinity purified

Immunogen: LRRC59 antibody was raised using the C terminal of LRRC59 corresponding to a region with amino acids KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC59 Blocking Peptide, catalog no. 33R-4365, is also available for use as a blocking control in assays to test for specificity of this LRRC59 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC59 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC59

Target: LRRC59 (Leucine Rich Repeat Containing 59 (LRRC59))

Andere Bezeichnung: LRRC59 (LRRC59 Produkte)

Synonyme: p34 antikoerper, PRO1855 antikoerper, AA959742 antikoerper, C78668 antikoerper, leucine rich repeat containing 59 antikoerper, leucine rich repeat containing 59 S homeolog antikoerper, LRRC59 antikoerper, Lrrc59 antikoerper, lrrc59.S antikoerper

Hintergrund: The function of LRRC59 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)