DOLPP1 Antikörper (N-Term)
-
- Target Alle DOLPP1 Antikörper anzeigen
- DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Maus, Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DOLPP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DOLPP1 antibody was raised against the N terminal of DOLPP1
- Aufreinigung
- Affinity purified
- Immunogen
- DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
- Top Product
- Discover our top product DOLPP1 Primärantikörper
-
anti-Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1) (AA 207-236), (C-Term) antibody
DOLPP1 Reaktivität: Maus WB Wirt: Kaninchen Polyclonal RB33347 unconjugated
anti-Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1) (N-Term) antibodyDOLPP1 Reaktivität: Maus, Ratte, Human, Rind (Kuh), Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Fledermaus, Affe, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DOLPP1 Blocking Peptide, catalog no. 33R-1013, is also available for use as a blocking control in assays to test for specificity of this DOLPP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOLPP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))
- Andere Bezeichnung
- DOLPP1 (DOLPP1 Produkte)
- Synonyme
- zgc:101585 antikoerper, lsfr2 antikoerper, DOLPP1 antikoerper, 0610011H20Rik antikoerper, AB030189 antikoerper, LSFR2 antikoerper, dolichyldiphosphatase 1 antikoerper, dolichyl pyrophosphate phosphatase 1 antikoerper, dolichyldiphosphatase 1 L homeolog antikoerper, DOLPP1 antikoerper, dolpp1 antikoerper, Dolpp1 antikoerper, dolpp1.L antikoerper
- Hintergrund
- DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.
- Molekulargewicht
- 27 kDa (MW of target protein)
-
