APMAP Antikörper (N-Term)
-
- Target Alle APMAP Antikörper anzeigen
- APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APMAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C20 ORF3 antibody was raised against the N terminal Of C20 rf3
- Aufreinigung
- Affinity purified
- Immunogen
- C20 ORF3 antibody was raised using the N terminal Of C20 rf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK
- Top Product
- Discover our top product APMAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C20ORF3 Blocking Peptide, catalog no. 33R-2640, is also available for use as a blocking control in assays to test for specificity of this C20ORF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))
- Andere Bezeichnung
- C20ORF3 (APMAP Produkte)
- Hintergrund
- C20orf3 exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. It may play a role in adipocyte differentiation.
- Molekulargewicht
- 46 kDa (MW of target protein)
-