Junctophilin 1 Antikörper (C-Term)
-
- Target Alle Junctophilin 1 (JPH1) Antikörper anzeigen
- Junctophilin 1 (JPH1)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Junctophilin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Junctophilin 1 antibody was raised against the C terminal of JPH1
- Aufreinigung
- Affinity purified
- Immunogen
- Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSP
- Top Product
- Discover our top product JPH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Junctophilin 1 Blocking Peptide, catalog no. 33R-8651, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Junctophilin 1 (JPH1)
- Andere Bezeichnung
- Junctophilin 1 (JPH1 Produkte)
- Synonyme
- JP-1 antikoerper, JP1 antikoerper, ENSMUSG00000054314 antikoerper, Jp1 antikoerper, bZ1M12.3 antikoerper, jph1 antikoerper, si:rp71-1m12.3 antikoerper, Jph1 antikoerper, junctophilin 1 antikoerper, junctophilin 1a antikoerper, junctophilin-1 antikoerper, JPH1 antikoerper, Jph1 antikoerper, jph1 antikoerper, jph1a antikoerper, LOC100547979 antikoerper
- Hintergrund
- Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH1 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.
- Molekulargewicht
- 72 kDa (MW of target protein)
-