GALNTL1 Antikörper (N-Term)
-
- Target Alle GALNTL1 Antikörper anzeigen
- GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALNTL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GALNTL1 antibody was raised against the N terminal Of Galntl1
- Aufreinigung
- Affinity purified
- Immunogen
- GALNTL1 antibody was raised using the N terminal Of Galntl1 corresponding to a region with amino acids LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP
- Top Product
- Discover our top product GALNTL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALNTL1 Blocking Peptide, catalog no. 33R-5407, is also available for use as a blocking control in assays to test for specificity of this GALNTL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNTL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNTL1 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1))
- Andere Bezeichnung
- GALNTL1 (GALNTL1 Produkte)
- Hintergrund
- GALNTL1 belongs to the glycosyltransferase 2 family, GalNAc-T subfamily. It contains 1 ricin B-type lectin domain. GALNTL1 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
- Molekulargewicht
- 63 kDa (MW of target protein)
-