CACHD1 Antikörper (N-Term)
-
- Target Alle CACHD1 Antikörper anzeigen
- CACHD1 (Cache Domain Containing 1 (CACHD1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CACHD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CACHD1 antibody was raised against the N terminal of CACHD1
- Aufreinigung
- Affinity purified
- Immunogen
- CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
- Top Product
- Discover our top product CACHD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CACHD1 Blocking Peptide, catalog no. 33R-3761, is also available for use as a blocking control in assays to test for specificity of this CACHD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACHD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACHD1 (Cache Domain Containing 1 (CACHD1))
- Andere Bezeichnung
- CACHD1 (CACHD1 Produkte)
- Hintergrund
- CACHD1 belongs to the calcium channel subunit alpha-2/delta family. It contains 2 cache domains and 1 VWFA domain. CACHD1 may regulate voltage-dependent calcium channels.
- Molekulargewicht
- 137 kDa (MW of target protein)
-