TNMD Antikörper (N-Term)

Produktnummer ABIN635478

Produktdetails anti-TNMD Antikörper

Target: TNMD (Tenomodulin (TNMD))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNMD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tenomodulin antibody was raised against the N terminal of TNMD

Aufreinigung: Affinity purified

Immunogen: Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tenomodulin Blocking Peptide, catalog no. 33R-4477, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNMD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNMD

Target: TNMD (Tenomodulin (TNMD))

Andere Bezeichnung: Tenomodulin (TNMD Produkte)

Synonyme: zgc:172161 antikoerper, TeM antikoerper, BRICD4 antikoerper, CHM1L antikoerper, TEM antikoerper, 1110017I01Rik antikoerper, Bricd4 antikoerper, ChM1L antikoerper, tenomodulin antikoerper, TNMD antikoerper, tnmd antikoerper, Tnmd antikoerper

Hintergrund: TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

Molekulargewicht: 37 kDa (MW of target protein)