TNMD Antikörper (N-Term)
-
- Target Alle TNMD Antikörper anzeigen
- TNMD (Tenomodulin (TNMD))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNMD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Tenomodulin antibody was raised against the N terminal of TNMD
- Aufreinigung
- Affinity purified
- Immunogen
- Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK
- Top Product
- Discover our top product TNMD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tenomodulin Blocking Peptide, catalog no. 33R-4477, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNMD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNMD (Tenomodulin (TNMD))
- Andere Bezeichnung
- Tenomodulin (TNMD Produkte)
- Hintergrund
- TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.
- Molekulargewicht
- 37 kDa (MW of target protein)
-