TMEM38A Antikörper (N-Term)
-
- Target Alle TMEM38A Antikörper anzeigen
- TMEM38A (Transmembrane Protein 38A (TMEM38A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM38A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM38 A antibody was raised against the N terminal of TMEM38
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM38 A antibody was raised using the N terminal of TMEM38 corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE
- Top Product
- Discover our top product TMEM38A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM38A Blocking Peptide, catalog no. 33R-3241, is also available for use as a blocking control in assays to test for specificity of this TMEM38A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM38A (Transmembrane Protein 38A (TMEM38A))
- Andere Bezeichnung
- TMEM38A (TMEM38A Produkte)
- Synonyme
- zgc:77831 antikoerper, MGC75707 antikoerper, TMEM38A antikoerper, TRIC-A antikoerper, TRICA antikoerper, 1110001E17Rik antikoerper, AI413399 antikoerper, mg33a antikoerper, RGD1307901 antikoerper, Srp-27 antikoerper, transmembrane protein 38A antikoerper, transmembrane protein 38a antikoerper, transmembrane protein 38A L homeolog antikoerper, tmem38a antikoerper, CpipJ_CPIJ011791 antikoerper, CpipJ_CPIJ013655 antikoerper, TMEM38A antikoerper, Tmem38a antikoerper, tmem38a.L antikoerper
- Hintergrund
- TMEM38A is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.
- Molekulargewicht
- 33 kDa (MW of target protein)
-