ESYT3 Antikörper
-
- Target Alle ESYT3 Antikörper anzeigen
- ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))
-
Reaktivität
- Ratte, Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ESYT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK
- Top Product
- Discover our top product ESYT3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM62C Blocking Peptide, catalog no. 33R-8085, is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM60 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ESYT3 (Extended Synaptotagmin-Like Protein 3 (ESYT3))
- Andere Bezeichnung
- FAM62C (ESYT3 Produkte)
- Synonyme
- Fam62c antikoerper, RGD1561304 antikoerper, fam62a antikoerper, fam62c antikoerper, FAM62A antikoerper, im:7153182 antikoerper, si:ch211-219a4.7 antikoerper, FAM62C antikoerper, DKFZp459I013 antikoerper, CHR3SYT antikoerper, E-Syt3 antikoerper, D930024E11 antikoerper, D9Ertd280e antikoerper, mKIAA4186 antikoerper, extended synaptotagmin 3 antikoerper, extended synaptotagmin protein 3 antikoerper, extended synaptotagmin-like protein 3 antikoerper, extended synaptotagmin-3 antikoerper, Esyt3 antikoerper, ESYT3 antikoerper, esyt3 antikoerper, LOC100468549 antikoerper, LOC100594943 antikoerper
- Hintergrund
- FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.
- Molekulargewicht
- 100 kDa (MW of target protein)
-