SPNS1/Spinster 1 Antikörper

Produktnummer ABIN635490

Produktdetails anti-SPNS1/Spinster 1 Antikörper

Target: SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPNS1/Spinster 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPNS1 Blocking Peptide, catalog no. 33R-1219, is also available for use as a blocking control in assays to test for specificity of this SPNS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPNS1/Spinster 1

Target: SPNS1/Spinster 1 (SPNS1) (Spinster Homolog 1 (SPNS1))

Andere Bezeichnung: SPNS1 (SPNS1 Produkte)

Synonyme: etID64740.3 antikoerper, nrs antikoerper, spinl antikoerper, wu:fb95b12 antikoerper, wu:fi37e11 antikoerper, 2210013K02Rik antikoerper, Spin1 antikoerper, Spinl antikoerper, HSpin1 antikoerper, LAT antikoerper, PP2030 antikoerper, SPIN1 antikoerper, SPINL antikoerper, spinster antikoerper, RGD1305613 antikoerper, sphingolipid transporter 1 (putative) antikoerper, spinster homolog 1 (Drosophila) antikoerper, spinster homolog 1 antikoerper, spinster homolog 1 L homeolog antikoerper, sphingolipid transporter 1 antikoerper, SPNS1 antikoerper, spns1 antikoerper, Spns1 antikoerper, spns1.L antikoerper

Hintergrund: SPNS1 is the Sphingolipid transporter. It may be involved in necrotic or autophagic cell death. It belongs to the major facilitator superfamily, spinster family.

Molekulargewicht: 56 kDa (MW of target protein)