RNFT2 Antikörper (N-Term)

Produktnummer ABIN635491

Produktdetails anti-RNFT2 Antikörper

Target: RNFT2 (Ring Finger Protein, Transmembrane 2 (RNFT2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNFT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM118 antibody was raised against the N terminal Of Tmem118

Aufreinigung: Affinity purified

Immunogen: TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM118 Blocking Peptide, catalog no. 33R-3736, is also available for use as a blocking control in assays to test for specificity of this TMEM118 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM118 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNFT2

Target: RNFT2 (Ring Finger Protein, Transmembrane 2 (RNFT2))

Andere Bezeichnung: TMEM118 (RNFT2 Produkte)

Synonyme: TMEM118 antikoerper, AW049082 antikoerper, B830028P19Rik antikoerper, Tmem118 antikoerper, RGD1560195 antikoerper, RNFT2 antikoerper, si:dkey-175n1.1 antikoerper, zgc:109947 antikoerper, ring finger protein, transmembrane 2 antikoerper, RNFT2 antikoerper, Rnft2 antikoerper, rnft2 antikoerper

Hintergrund: TMEM118 is a multi-pass membrane protein, and contains 1 RING-type zinc finger. The function of TMEM118 remains unknown.

Molekulargewicht: 46 kDa (MW of target protein)