ORAI2 Antikörper (Middle Region)
-
- Target Alle ORAI2 Antikörper anzeigen
- ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ORAI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ORAI2 antibody was raised against the middle region of ORAI2
- Aufreinigung
- Affinity purified
- Immunogen
- ORAI2 antibody was raised using the middle region of ORAI2 corresponding to a region with amino acids IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ
- Top Product
- Discover our top product ORAI2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ORAI2 Blocking Peptide, catalog no. 33R-3944, is also available for use as a blocking control in assays to test for specificity of this ORAI2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))
- Andere Bezeichnung
- ORAI2 (ORAI2 Produkte)
- Synonyme
- C7orf19 antikoerper, CBCIP2 antikoerper, MEM142B antikoerper, TMEM142B antikoerper, A730041O15Rik antikoerper, Tmem142b antikoerper, RGD1310213 antikoerper, ORAI2 antikoerper, orai-1 antikoerper, orai1 antikoerper, tmem142a antikoerper, tmem142b antikoerper, LOC100230993 antikoerper, ORAI calcium release-activated calcium modulator 2 antikoerper, ORAI calcium release-activated calcium modulator 2 S homeolog antikoerper, ORAI2 antikoerper, Orai2 antikoerper, orai2.S antikoerper, orai2 antikoerper
- Hintergrund
- ORAI2 is a multi-pass membrane protein, and it belongs to the Orai family. It is a Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.
- Molekulargewicht
- 28 kDa (MW of target protein)
-