LRRC37B Antikörper (N-Term)

Produktnummer ABIN635493

Produktdetails anti-LRRC37B Antikörper

Target: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC37B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC37 B antibody was raised against the N terminal of LRRC37

Aufreinigung: Affinity purified

Immunogen: LRRC37 B antibody was raised using the N terminal of LRRC37 corresponding to a region with amino acids VSRPTKFVVSPKNLKKDLAERWSLPEIVGIPHQLSKPQRQKQTLPDDYLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC37B Blocking Peptide, catalog no. 33R-9822, is also available for use as a blocking control in assays to test for specificity of this LRRC37B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC37B

Target: LRRC37B (Leucine Rich Repeat Containing 37B (LRRC37B))

Andere Bezeichnung: LRRC37B (LRRC37B Produkte)

Synonyme: DKFZp459F1551 antikoerper, leucine rich repeat containing 37B antikoerper, leucine-rich repeat-containing protein 37B antikoerper, LRRC37B antikoerper, LOC749894 antikoerper

Hintergrund: The function of LRRC37B protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 105 kDa (MW of target protein)