Sphingomyelin Synthase 2 Antikörper (N-Term)

Produktnummer ABIN635498

Produktdetails anti-Sphingomyelin Synthase 2 Antikörper

Target: Sphingomyelin Synthase 2 (SGMS2)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sphingomyelin Synthase 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SGMS2 antibody was raised against the N terminal of SGMS2

Aufreinigung: Affinity purified

Immunogen: SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SGMS2 Blocking Peptide, catalog no. 33R-4377, is also available for use as a blocking control in assays to test for specificity of this SGMS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sphingomyelin Synthase 2

Target: Sphingomyelin Synthase 2 (SGMS2)

Andere Bezeichnung: SGMS2 (SGMS2 Produkte)

Synonyme: SMS2 antikoerper, 4933405A16Rik antikoerper, 5133401H06Rik antikoerper, AI854299 antikoerper, RGD1305778 antikoerper, spermatin antikoerper, sphingomyelin synthase 2 antikoerper, sgms2 antikoerper, SGMS2 antikoerper, Sgms2 antikoerper

Hintergrund: SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognises the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognised efficiently as a substrate. SGMS2 does not function strictly as a SM synthase.

Molekulargewicht: 42 kDa (MW of target protein)