INSIG2 Antikörper (N-Term)
-
- Target Alle INSIG2 Antikörper anzeigen
- INSIG2 (Insulin Induced Gene 2 (INSIG2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser INSIG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- INSIG2 antibody was raised against the N terminal of INSIG2
- Aufreinigung
- Affinity purified
- Immunogen
- INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ
- Top Product
- Discover our top product INSIG2 Primärantikörper
-
anti-Insulin Induced Gene 2 (INSIG2) (AA 50-150) antibody
INSIG2 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Insulin Induced Gene 2 (INSIG2) antibodyINSIG2 Reaktivität: Human, Maus, Ratte ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Insulin Induced Gene 2 (INSIG2) (N-Term) antibodyINSIG2 Reaktivität: Human, Kaninchen, Rind (Kuh), Ziege, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Insulin Induced Gene 2 (INSIG2) (N-Term) antibodyINSIG2 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Insulin Induced Gene 2 (INSIG2) (N-Term) antibodyINSIG2 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Ziege, Pferd, Schwein, Hund, Schaf WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
INSIG2 Blocking Peptide, catalog no. 33R-5639, is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- INSIG2 (Insulin Induced Gene 2 (INSIG2))
- Andere Bezeichnung
- INSIG2 (INSIG2 Produkte)
- Synonyme
- MGC82156 antikoerper, INSIG-2 antikoerper, 2900053I11Rik antikoerper, C730043J18Rik antikoerper, Insig-2 antikoerper, insulin induced gene 2 antikoerper, insulin induced gene 2 L homeolog antikoerper, insig2 antikoerper, insig2.L antikoerper, INSIG2 antikoerper, Insig2 antikoerper
- Hintergrund
- INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-
