Claudin 18 Antikörper (C-Term)

Produktnummer ABIN635505

Produktdetails anti-Claudin 18 Antikörper

Target: Claudin 18 (CLDN18)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Claudin 18 antibody was raised against the C terminal of CLDN18

Aufreinigung: Affinity purified

Immunogen: Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 18 Blocking Peptide, catalog no. 33R-7040, is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 18

Target: Claudin 18 (CLDN18)

Andere Bezeichnung: Claudin 18 (CLDN18 Produkte)

Synonyme: claudin-18 antikoerper, CLDN18 antikoerper, SFTA5 antikoerper, SFTPJ antikoerper, claudin 18 L homeolog antikoerper, claudin 18 antikoerper, cldn18.L antikoerper, CLDN18 antikoerper, Cldn18 antikoerper

Hintergrund: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C