HEPACAM Antikörper (N-Term)

Produktnummer ABIN635516

Produktdetails anti-HEPACAM Antikörper

Target: HEPACAM (Hepatic and Glial Cell Adhesion Molecule (HEPACAM))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HEPACAM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HEPACAM antibody was raised against the N terminal of HEPACAM

Aufreinigung: Affinity purified

Immunogen: HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HEPACAM Blocking Peptide, catalog no. 33R-5163, is also available for use as a blocking control in assays to test for specificity of this HEPACAM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEPACAM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HEPACAM

Target: HEPACAM (Hepatic and Glial Cell Adhesion Molecule (HEPACAM))

Andere Bezeichnung: HEPACAM (HEPACAM Produkte)

Synonyme: GlialCAM antikoerper, MLC2A antikoerper, MLC2B antikoerper, 2900042E01Rik antikoerper, Hepn1 antikoerper, hepatic and glial cell adhesion molecule antikoerper, hepatocyte cell adhesion molecule antikoerper, HEPACAM antikoerper, Hepacam antikoerper

Hintergrund: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Molekulargewicht: 46 kDa (MW of target protein)