ABHD13 Antikörper (N-Term)
-
- Target Alle ABHD13 Antikörper anzeigen
- ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABHD13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ABHD13 antibody was raised against the N terminal of ABHD13
- Aufreinigung
- Affinity purified
- Immunogen
- ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
- Top Product
- Discover our top product ABHD13 Primärantikörper
-
anti-Abhydrolase Domain Containing 13 (ABHD13) (Internal Region) antibody
ABHD13 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 13 (ABHD13) (C-Term) antibodyABHD13 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Affe, Meerschweinchen, Xenopus laevis, Huhn, Hamster, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 13 (ABHD13) (AA 74-123) antibodyABHD13 Reaktivität: Human, Ratte, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 13 (ABHD13) (C-Term) antibodyABHD13 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABHD13 Blocking Peptide, catalog no. 33R-8762, is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABHD13 (Abhydrolase Domain Containing 13 (ABHD13))
- Andere Bezeichnung
- ABHD13 (ABHD13 Produkte)
- Synonyme
- BEM46L1 antikoerper, C13orf6 antikoerper, RP11-153I24.2 antikoerper, bA153I24.2 antikoerper, 1110065L07Rik antikoerper, AI463703 antikoerper, AI788994 antikoerper, RGD1308317 antikoerper, zgc:123286 antikoerper, abhydrolase domain containing 13 antikoerper, abhydrolase domain containing 13 S homeolog antikoerper, ABHD13 antikoerper, abhd13 antikoerper, abhd13.S antikoerper, Abhd13 antikoerper
- Hintergrund
- ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.
- Molekulargewicht
- 38 kDa (MW of target protein)
-
