WDR33 Antikörper (Middle Region)
-
- Target Alle WDR33 Antikörper anzeigen
- WDR33 (WD Repeat Domain 33 (WDR33))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WDR33 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDR33 antibody was raised against the middle region of WDR33
- Aufreinigung
- Affinity purified
- Immunogen
- WDR33 antibody was raised using the middle region of WDR33 corresponding to a region with amino acids TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL
- Top Product
- Discover our top product WDR33 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDR33 Blocking Peptide, catalog no. 33R-9138, is also available for use as a blocking control in assays to test for specificity of this WDR33 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR33 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR33 (WD Repeat Domain 33 (WDR33))
- Andere Bezeichnung
- WDR33 (WDR33 Produkte)
- Synonyme
- zgc:110570 antikoerper, WDR33 antikoerper, Wdr33 antikoerper, NET14 antikoerper, WDC146 antikoerper, 1110001N06Rik antikoerper, 2310011G05Rik antikoerper, 2810021O11Rik antikoerper, 8430413N20Rik antikoerper, WD repeat domain 33 antikoerper, pre-mRNA 3' end processing protein WDR33 antikoerper, wdr33 antikoerper, WDR33 antikoerper, Wdr33 antikoerper, LOC100548555 antikoerper
- Hintergrund
- WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
- Molekulargewicht
- 30 kDa (MW of target protein)
-