Seladin 1 Antikörper (Middle Region)
-
- Target Alle Seladin 1 (DHCR24) Antikörper anzeigen
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Seladin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DHCR24 antibody was raised against the middle region of DHCR24
- Aufreinigung
- Affinity purified
- Immunogen
- DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
- Top Product
- Discover our top product DHCR24 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHCR24 Blocking Peptide, catalog no. 33R-1138, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
- Andere Bezeichnung
- DHCR24 (DHCR24 Produkte)
- Synonyme
- MGC82737 antikoerper, zgc:101638 antikoerper, DCE antikoerper, Nbla03646 antikoerper, SELADIN1 antikoerper, seladin-1 antikoerper, 2310076D10Rik antikoerper, 5830417J06Rik antikoerper, mKIAA0018 antikoerper, 24-dehydrocholesterol reductase antikoerper, 24-dehydrocholesterol reductase S homeolog antikoerper, delta(24)-sterol reductase antikoerper, DHCR24 antikoerper, dhcr24.S antikoerper, dhcr24 antikoerper, LOC5575872 antikoerper, CpipJ_CPIJ000670 antikoerper, Dhcr24 antikoerper
- Hintergrund
- DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis.
- Molekulargewicht
- 58 kDa (MW of target protein)
-