UNC5A Antikörper
-
- Target Alle UNC5A Antikörper anzeigen
- UNC5A (Unc-5 Homolog A (UNC5A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UNC5A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UNC5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
- Top Product
- Discover our top product UNC5A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UNC5A Blocking Peptide, catalog no. 33R-9915, is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UNC5A (Unc-5 Homolog A (UNC5A))
- Andere Bezeichnung
- UNC5A (UNC5A Produkte)
- Synonyme
- zgc:175190 antikoerper, UNC5H1 antikoerper, Unc5h1 antikoerper, mKIAA1976 antikoerper, unc-5 netrin receptor A antikoerper, netrin receptor UNC5A antikoerper, UNC5A antikoerper, Tsp_02512 antikoerper, Tsp_13881 antikoerper, unc5a antikoerper, Unc5a antikoerper
- Hintergrund
- UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.
- Molekulargewicht
- 93 kDa (MW of target protein)
-