UST Antikörper (N-Term)
-
- Target Alle UST Antikörper anzeigen
- UST (Uronyl-2-Sulfotransferase (UST))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UST Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UST antibody was raised against the N terminal of UST
- Aufreinigung
- Affinity purified
- Immunogen
- UST antibody was raised using the N terminal of UST corresponding to a region with amino acids PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
- Top Product
- Discover our top product UST Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UST Blocking Peptide, catalog no. 33R-7275, is also available for use as a blocking control in assays to test for specificity of this UST antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UST antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UST (Uronyl-2-Sulfotransferase (UST))
- Andere Bezeichnung
- UST (UST Produkte)
- Synonyme
- si:dkey-185l3.2 antikoerper, 2OST antikoerper, D930010O20Rik antikoerper, UA2OST antikoerper, uronyl 2-sulfotransferase antikoerper, uronyl-2-sulfotransferase antikoerper, UST antikoerper, ust antikoerper, Ust antikoerper
- Hintergrund
- UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-