SAYSD1 Antikörper (C-Term)

Produktnummer ABIN635537

Produktdetails anti-SAYSD1 Antikörper

Target: SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAYSD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C6 ORF64 antibody was raised against the C terminal Of C6 rf64

Aufreinigung: Affinity purified

Immunogen: C6 ORF64 antibody was raised using the C terminal Of C6 rf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF64 Blocking Peptide, catalog no. 33R-6632, is also available for use as a blocking control in assays to test for specificity of this C6ORF64 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAYSD1

Target: SAYSD1 (SAYSVFN Motif Domain Containing 1 (SAYSD1))

Andere Bezeichnung: C6ORF64 (SAYSD1 Produkte)

Synonyme: C6orf64 antikoerper, SAYSD1 antikoerper, C23H6orf64 antikoerper, 1810063B07Rik antikoerper, 4930488P03Rik antikoerper, SAYSVFN motif domain containing 1 antikoerper, SAYSD1 antikoerper, Saysd1 antikoerper

Hintergrund: The function of C6orf64 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 20 kDa (MW of target protein)