Reticulon 1 Antikörper (N-Term)
-
- Target Alle Reticulon 1 (RTN1) Antikörper anzeigen
- Reticulon 1 (RTN1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Reticulon 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RTN1 antibody was raised against the N terminal of RTN1
- Aufreinigung
- Affinity purified
- Immunogen
- RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR
- Top Product
- Discover our top product RTN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RTN1 Blocking Peptide, catalog no. 33R-2384, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Reticulon 1 (RTN1)
- Andere Bezeichnung
- RTN1 (RTN1 Produkte)
- Hintergrund
- Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
- Molekulargewicht
- 39 kDa (MW of target protein)
-