GOLGA5 Antikörper (N-Term)

Produktnummer ABIN635542

Produktdetails anti-GOLGA5 Antikörper

Target: GOLGA5 (Golgin A5 (GOLGA5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GOLGA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GOLGA5 antibody was raised against the N terminal of GOLGA5

Aufreinigung: Affinity purified

Immunogen: GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GOLGA5 Blocking Peptide, catalog no. 33R-3120, is also available for use as a blocking control in assays to test for specificity of this GOLGA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GOLGA5

Target: GOLGA5 (Golgin A5 (GOLGA5))

Andere Bezeichnung: GOLGA5 (GOLGA5 Produkte)

Hintergrund: GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues.

Molekulargewicht: 83 kDa (MW of target protein)