AWAT2 Antikörper (C-Term)
-
- Target Alle AWAT2 Produkte
- AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AWAT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DGAT2 L4 antibody was raised against the C terminal of DGAT2 4
- Aufreinigung
- Affinity purified
- Immunogen
- DGAT2 L4 antibody was raised using the C terminal of DGAT2 4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DGAT2L4 Blocking Peptide, catalog no. 33R-3242, is also available for use as a blocking control in assays to test for specificity of this DGAT2L4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGAT0 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AWAT2 (Acyl-CoA Wax Alcohol Acyltransferase 2 (AWAT2))
- Andere Bezeichnung
- DGAT2L4 (AWAT2 Produkte)
- Hintergrund
- DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. It has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols.
- Molekulargewicht
- 38 kDa (MW of target protein)
-