PEX10 Antikörper (C-Term)
-
- Target Alle PEX10 Antikörper anzeigen
- PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEX10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PEX10 antibody was raised against the C terminal of PEX10
- Aufreinigung
- Affinity purified
- Immunogen
- PEX10 antibody was raised using the C terminal of PEX10 corresponding to a region with amino acids ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
- Top Product
- Discover our top product PEX10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEX10 Blocking Peptide, catalog no. 33R-2712, is also available for use as a blocking control in assays to test for specificity of this PEX10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))
- Andere Bezeichnung
- PEX10 (PEX10 Produkte)
- Hintergrund
- PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-