UBE2D2 Antikörper
-
- Target Alle UBE2D2 Antikörper anzeigen
- UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2D2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSIC
- Top Product
- Discover our top product UBE2D2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2D2 Blocking Peptide, catalog no. 33R-9123, is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))
- Andere Bezeichnung
- UBE2D2 (UBE2D2 Produkte)
- Synonyme
- E2(17)KB2 antikoerper, PUBC1 antikoerper, UBC4 antikoerper, UBC4/5 antikoerper, UBCH5B antikoerper, 1500034D03Rik antikoerper, Ubc2e antikoerper, Ube2d2 antikoerper, ubc4 antikoerper, ube2d2 antikoerper, zgc:55886 antikoerper, E217kB antikoerper, ubiquitin conjugating enzyme E2 D2 antikoerper, ubiquitin-conjugating enzyme E2D 2A antikoerper, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) antikoerper, ubiquitin-conjugating enzyme E2D 2 antikoerper, ubiquitin conjugating enzyme E2 D3 antikoerper, UBE2D2 antikoerper, Ube2d2a antikoerper, ube2d2 antikoerper, Ube2d2 antikoerper, UBE2D3 antikoerper
- Hintergrund
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
- Molekulargewicht
- 17 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Toll-Like Receptors Cascades
-