OCA2 Antikörper (Middle Region)
-
- Target Alle OCA2 Antikörper anzeigen
- OCA2 (P Protein (OCA2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OCA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OCA2 antibody was raised against the middle region of OCA2
- Aufreinigung
- Affinity purified
- Immunogen
- OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC
- Top Product
- Discover our top product OCA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OCA2 Blocking Peptide, catalog no. 33R-5036, is also available for use as a blocking control in assays to test for specificity of this OCA2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Distal Regeneration Involves the Age Dependent Activity of Branchial Sac Stem Cells in the Ascidian Ciona intestinalis." in: Regeneration (Oxford, England), Vol. 2, Issue 1, pp. 1-18, (2015) (PubMed).
: "
-
Distal Regeneration Involves the Age Dependent Activity of Branchial Sac Stem Cells in the Ascidian Ciona intestinalis." in: Regeneration (Oxford, England), Vol. 2, Issue 1, pp. 1-18, (2015) (PubMed).
-
- Target
- OCA2 (P Protein (OCA2))
- Andere Bezeichnung
- OCA2 (OCA2 Produkte)
- Substanzklasse
- Viral Protein
- Hintergrund
- This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.
- Molekulargewicht
- 93 kDa (MW of target protein)
-