SC5DL Antikörper

Produktnummer ABIN635551

Produktdetails anti-SC5DL Antikörper

Target: SC5DL (Sterol-C5-Desaturase (SC5DL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SC5DL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SC5 DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SC5DL Blocking Peptide, catalog no. 33R-6850, is also available for use as a blocking control in assays to test for specificity of this SC5DL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 L antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SC5DL

Target: SC5DL (Sterol-C5-Desaturase (SC5DL))

Andere Bezeichnung: SC5DL (SC5DL Produkte)

Synonyme: A830037K02 antikoerper, A830073K23Rik antikoerper, Sc5dl antikoerper, ERG3 antikoerper, S5DES antikoerper, SC5DL antikoerper, sc5d antikoerper, sc5dl antikoerper, sterol-C5-desaturase antikoerper, sterol-C5-desaturase L homeolog antikoerper, Sc5d antikoerper, SC5D antikoerper, sc5d.L antikoerper

Hintergrund: This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.

Molekulargewicht: 35 kDa (MW of target protein)