PIPOX Antikörper (C-Term)
-
- Target Alle PIPOX Antikörper anzeigen
- PIPOX (Pipecolic Acid Oxidase (PIPOX))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIPOX Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIPOX antibody was raised against the C terminal of PIPOX
- Aufreinigung
- Affinity purified
- Immunogen
- PIPOX antibody was raised using the C terminal of PIPOX corresponding to a region with amino acids FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
- Top Product
- Discover our top product PIPOX Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIPOX Blocking Peptide, catalog no. 33R-3119, is also available for use as a blocking control in assays to test for specificity of this PIPOX antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIPOX antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIPOX (Pipecolic Acid Oxidase (PIPOX))
- Andere Bezeichnung
- PIPOX (PIPOX Produkte)
- Hintergrund
- PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.
- Molekulargewicht
- 43 kDa (MW of target protein)
-