FIBCD1 Antikörper (C-Term)
-
- Target Alle FIBCD1 Antikörper anzeigen
- FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FIBCD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FIBCD1 antibody was raised against the C terminal of FIBCD1
- Aufreinigung
- Affinity purified
- Immunogen
- FIBCD1 antibody was raised using the C terminal of FIBCD1 corresponding to a region with amino acids DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY
- Top Product
- Discover our top product FIBCD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FIBCD1 Blocking Peptide, catalog no. 33R-1972, is also available for use as a blocking control in assays to test for specificity of this FIBCD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FIBCD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FIBCD1 (Fibrinogen C Domain Containing 1 (FIBCD1))
- Andere Bezeichnung
- FIBCD1 (FIBCD1 Produkte)
- Synonyme
- fibcd1 antikoerper, AI448887 antikoerper, RGD1309097 antikoerper, fibrinogen C domain containing 1 antikoerper, fibrinogen C domain containing 1 L homeolog antikoerper, FIBCD1 antikoerper, fibcd1.L antikoerper, Fibcd1 antikoerper
- Hintergrund
- FIBCD1 is a single-pass membrane protein. It contains 1 fibrinogen C-terminal domain. The exact function of FIBCD1 remains unknown.
- Molekulargewicht
- 51 kDa (MW of target protein)
-