SUN2 Antikörper

Produktnummer ABIN635564

Produktdetails anti-SUN2 Antikörper

Target: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC84B Blocking Peptide, catalog no. 33R-1831, is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUN2

Target: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Andere Bezeichnung: UNC84B (SUN2 Produkte)

Synonyme: UNC84B antikoerper, B230369L08Rik antikoerper, C030011B15 antikoerper, Unc84b antikoerper, RGD1563141 antikoerper, Sad1 and UNC84 domain containing 2 antikoerper, SUN2 antikoerper, Sun2 antikoerper

Hintergrund: UNC84B plays a role in mitotic spindle organization and biogenesis.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion