TMPRSS5 Antikörper

Produktnummer ABIN635571

Produktdetails anti-TMPRSS5 Antikörper

Target: TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMPRSS5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TMPRSS5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMPRSS5 Blocking Peptide, catalog no. 33R-8944, is also available for use as a blocking control in assays to test for specificity of this TMPRSS5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMPRSS5

Target: TMPRSS5 (Transmembrane Protease, serine 5 (TMPRSS5))

Andere Bezeichnung: TMPRSS5 (TMPRSS5 Produkte)

Synonyme: TMPRSS5 antikoerper, SPINESIN antikoerper, Amp antikoerper, spinesin antikoerper, transmembrane protease, serine 5 antikoerper, transmembrane protease, serine 5 (spinesin) antikoerper, TMPRSS5 antikoerper, Tmprss5 antikoerper

Hintergrund: TMPRSS5 belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. TMPRSS5 may play a role in hearing.

Molekulargewicht: 22 kDa (MW of target protein)