Sideroflexin 4 Antikörper (C-Term)

Produktnummer ABIN635574

Produktdetails anti-Sideroflexin 4 Antikörper

Target: Sideroflexin 4 (SFXN4)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sideroflexin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Sideroflexin 4 antibody was raised against the C terminal of SFXN4

Aufreinigung: Affinity purified

Immunogen: Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Sideroflexin 4 Blocking Peptide, catalog no. 33R-8343, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sideroflexin 4

Target: Sideroflexin 4 (SFXN4)

Andere Bezeichnung: Sideroflexin 4 (SFXN4 Produkte)

Synonyme: im:7151335 antikoerper, si:ch211-117n7.3 antikoerper, zgc:153199 antikoerper, BCRM1 antikoerper, sideroflexin 4 antikoerper, Sfxn4 antikoerper, SFXN4 antikoerper, sfxn4 antikoerper

Hintergrund: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis