PLP1 Antikörper (Middle Region)

Produktnummer ABIN635575

Produktdetails anti-PLP1 Antikörper

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLP1 antibody was raised against the middle region of PLP1

Aufreinigung: Affinity purified

Immunogen: PLP1 antibody was raised using the middle region of PLP1 corresponding to a region with amino acids IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLP1 Blocking Peptide, catalog no. 33R-4219, is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLP1

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Andere Bezeichnung: PLP1 (PLP1 Produkte)

Synonyme: GPM6C antikoerper, HLD1 antikoerper, MMPL antikoerper, PLP antikoerper, PLP/DM20 antikoerper, PMD antikoerper, SPG2 antikoerper, Plp antikoerper, PLP1 antikoerper, plp1 antikoerper, DKFZp459O081 antikoerper, DKFZp459O113 antikoerper, DM20 antikoerper, jimpy antikoerper, jp antikoerper, msd antikoerper, rsh antikoerper, plp antikoerper, hld1 antikoerper, mmpl antikoerper, plp1a antikoerper, pmd antikoerper, spg2 antikoerper, DMalpha2c antikoerper, wu:fc27f01 antikoerper, wu:fj36d03 antikoerper, wu:fj42d08 antikoerper, zgc:110499 antikoerper, PLP-B antikoerper, plp1-a antikoerper, plp1-b antikoerper, plp1b antikoerper, proteolipid protein 1 antikoerper, proteolipid protein (myelin) 1 antikoerper, myelin proteolipid protein antikoerper, proteolipid protein 1 L homeolog antikoerper, proteolipid protein 1a antikoerper, proteolipid protein 1 S homeolog antikoerper, PLP1 antikoerper, Plp1 antikoerper, plp1 antikoerper, Tsp_11640 antikoerper, plp antikoerper, plp1.L antikoerper, plp1a antikoerper, plp1.S antikoerper

Hintergrund: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2.

Molekulargewicht: 30 kDa (MW of target protein)