TMEM8B Antikörper (N-Term)
-
- Target Alle TMEM8B Antikörper anzeigen
- TMEM8B (Transmembrane Protein 8B (TMEM8B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM8B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- C9 ORF127 antibody was raised against the N terminal Of C9 rf127
- Aufreinigung
- Affinity purified
- Immunogen
- C9 ORF127 antibody was raised using the N terminal Of C9 rf127 corresponding to a region with amino acids MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS
- Top Product
- Discover our top product TMEM8B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C9ORF127 Blocking Peptide, catalog no. 33R-6253, is also available for use as a blocking control in assays to test for specificity of this C9ORF127 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF127 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM8B (Transmembrane Protein 8B (TMEM8B))
- Andere Bezeichnung
- C9ORF127 (TMEM8B Produkte)
- Hintergrund
- The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.
- Molekulargewicht
- 37 kDa (MW of target protein)
-