FAM200A Antikörper (Middle Region)

Produktnummer ABIN635578

Produktdetails anti-FAM200A Antikörper

Target: FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM200A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C7 ORF38 antibody was raised against the middle region of C7 rf38

Aufreinigung: Affinity purified

Immunogen: C7 ORF38 antibody was raised using the middle region of C7 rf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C7ORF38 Blocking Peptide, catalog no. 33R-7749, is also available for use as a blocking control in assays to test for specificity of this C7ORF38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM200A

Target: FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))

Andere Bezeichnung: C7ORF38 (C7orf38 Produkte)

Synonyme: C7orf38 antikoerper, family with sequence similarity 200 member A antikoerper, FAM200A antikoerper

Hintergrund: The function of C7ORF38 protein has not been widely studied, and is yet to be fully elucidated. The protein is weakly similar to transposase-like proteins in human and mouse.

Molekulargewicht: 66 kDa (MW of target protein)