C17orf78 Antikörper (Middle Region)

Produktnummer ABIN635579

Produktdetails anti-C17orf78 Antikörper

Target: C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C17orf78 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C17 ORF78 antibody was raised against the middle region of C17 rf78

Aufreinigung: Affinity purified

Immunogen: C17 ORF78 antibody was raised using the middle region of C17 rf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF78 Blocking Peptide, catalog no. 33R-4963, is also available for use as a blocking control in assays to test for specificity of this C17ORF78 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C17orf78

Target: C17orf78 (Chromosome 17 Open Reading Frame78 (C17orf78))

Andere Bezeichnung: C17ORF78 (C17orf78 Produkte)

Synonyme: chromosome 17 open reading frame 78 antikoerper, C17orf78 antikoerper

Hintergrund: The exact function of the protein encoded by this gene is not known.

Molekulargewicht: 30 kDa (MW of target protein)