TECR Antikörper (Middle Region)

Produktnummer ABIN635589

Produktdetails anti-TECR Antikörper

Target: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TECR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GPSN2 antibody was raised against the middle region of GPSN2

Aufreinigung: Affinity purified

Immunogen: GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPSN2 Blocking Peptide, catalog no. 33R-7077, is also available for use as a blocking control in assays to test for specificity of this GPSN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TECR

Target: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Andere Bezeichnung: GPSN2 (TECR Produkte)

Synonyme: GPSN2 antikoerper, MRT14 antikoerper, SC2 antikoerper, TER antikoerper, 2410016D23Rik antikoerper, A230102P12Rik antikoerper, AI173355 antikoerper, D17Ertd178e antikoerper, Gpsn2 antikoerper, cb250 antikoerper, gpsn2 antikoerper, mg:db03b10 antikoerper, sb:cb250 antikoerper, wu:fj63b12 antikoerper, glycoprotein, synaptic 2 antikoerper, trans-2,3-enoyl-CoA reductase antikoerper, trans-2,3-enoyl-CoA reductase b antikoerper, gpsn2 antikoerper, TECR antikoerper, Tecr antikoerper, tecrb antikoerper

Hintergrund: Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA.

Molekulargewicht: 36 kDa (MW of target protein)