VSIG1 Antikörper (N-Term)

Produktnummer ABIN635590

Produktdetails anti-VSIG1 Antikörper

Target: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VSIG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VSIG1 antibody was raised against the N terminal of VSIG1

Aufreinigung: Affinity purified

Immunogen: VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VSIG1 Blocking Peptide, catalog no. 33R-8544, is also available for use as a blocking control in assays to test for specificity of this VSIG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VSIG1

Target: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Andere Bezeichnung: VSIG1 (VSIG1 Produkte)

Synonyme: VSIG1 antikoerper, vsig1 antikoerper, CHT1 antikoerper, 1700062D20Rik antikoerper, GPA34 antikoerper, dJ889N15.1 antikoerper, 4930405J24Rik antikoerper, ctx antikoerper, ctx-A antikoerper, gpa34 antikoerper, V-set and immunoglobulin domain containing 1 antikoerper, V-set and immunoglobulin domain containing 1 L homeolog antikoerper, VSIG1 antikoerper, vsig1 antikoerper, Vsig1 antikoerper, vsig1.L antikoerper

Hintergrund: The function of VSIG1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)