ZP1 Antikörper
-
- Target Alle ZP1 Antikörper anzeigen
- ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL
- Top Product
- Discover our top product ZP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZP1 Blocking Peptide, catalog no. 33R-7410, is also available for use as a blocking control in assays to test for specificity of this ZP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))
- Andere Bezeichnung
- ZP1 (ZP1 Produkte)
- Synonyme
- zona pellucida glycoprotein 1 (sperm receptor) antikoerper, zona pellucida glycoprotein 1 antikoerper, ZP1 antikoerper, Zp1 antikoerper
- Hintergrund
- The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.
- Molekulargewicht
- 70 kDa (MW of target protein)
-